PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G19800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 244aa    MW: 26511.6 Da    PI: 7.2375
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G19800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.5e-1962115356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++++eq+e Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  OGLUM07G19800.1  62 KKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHK 115
                      45589***********************************************99 PP

2HD-ZIP_I/II116.21.8e-3762152292
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      kkrrls+eqv++LE sF+ee+kLe+ rKv+la+eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le+ev +L+e+l 
  OGLUM07G19800.1  62 KKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHKSKLLEEEFSKLKHAHDAAILHKCHLENEVLRLKERLV 152
                      9**************************************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.29357117IPR001356Homeobox domain
SuperFamilySSF466891.0E-1659116IPR009057Homeodomain-like
SMARTSM003899.7E-1760121IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-1862115IPR009057Homeodomain-like
PfamPF000464.1E-1662115IPR001356Homeobox domain
CDDcd000863.59E-1562117No hitNo description
PRINTSPR000311.9E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000311.9E-597113IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDRYGEKQQQ QQMFASYVDA SLLAASGEVQ GERPRARRRR RRGARCVGGG GGGGEVDGGD  60
PKKRRLSDEQ VEMLELSFRE ERKLETGRKV HLASELGLDP KQVAVWFQNR RARHKSKLLE  120
EEFSKLKHAH DAAILHKCHL ENEVLRLKER LVVAEEEVRR LRSAAGSHTA SGEGGDIMGL  180
GGSGACVAGS PSSSFSTGTC QPPSFGGGGG GGDHLGDDDL VYVPEYGGYA DNSVVEWFSL  240
YGLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13241RPRARRRRRR
23644RRRRRRGAR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218890.0AK121889.1 Oryza sativa Japonica Group cDNA clone:J033105B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646179.11e-133PREDICTED: homeobox-leucine zipper protein HOX14
SwissprotA2YN171e-179HOX14_ORYSI; Homeobox-leucine zipper protein HOX14
TrEMBLA0A0D3GSU11e-177A0A0D3GSU1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0I2V31e-177A0A0E0I2V3_ORYNI; Uncharacterized protein
TrEMBLA0A0E0ALW31e-177A0A0E0ALW3_9ORYZ; Uncharacterized protein
STRINGORGLA07G0257600.11e-176(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-31homeobox protein 40